PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009590186.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 299aa    MW: 33824.3 Da    PI: 7.6029
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009590186.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.41.4e-19133187256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tk+q  +Lee F+++++++ ++++ LAk+lgL  rqV vWFqNrRa+ k
  XP_009590186.1 133 RKKLRLTKDQSAVLEESFKEHNTLNPKQKQALAKRLGLRPRQVEVWFQNRRARTK 187
                     678899***********************************************98 PP

2HD-ZIP_I/II1292e-41133222191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rl+k+q+++LEesF+e+++L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  XP_009590186.1 133 RKKLRLTKDQSAVLEESFKEHNTLNPKQKQALAKRLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELR-AL 222
                     69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.5E-281110IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466891.38E-18127190IPR009057Homeodomain-like
PROSITE profilePS5007117.378129189IPR001356Homeobox domain
SMARTSM003893.0E-17131193IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-18133187IPR009057Homeodomain-like
PfamPF000465.2E-17133187IPR001356Homeobox domain
CDDcd000863.13E-15133190No hitNo description
PRINTSPR000311.5E-5160169IPR000047Helix-turn-helix motif
PROSITE patternPS000270164187IPR017970Homeobox, conserved site
PRINTSPR000311.5E-5169185IPR000047Helix-turn-helix motif
SMARTSM003404.2E-27189232IPR003106Leucine zipper, homeobox-associated
PfamPF021832.3E-11189223IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MLENQDLGLK LSLGFPENKT TNPLQLNLIS SLASSTSPSP SPFNLFQKTS WIDSFPSSDR  60
NLETCRTFLK GIDVNRIPTI TDAEEEEEAG VSSPNSTISS LSGNKRSERE INCEEELDCC  120
RGISDEEDGE TCRKKLRLTK DQSAVLEESF KEHNTLNPKQ KQALAKRLGL RPRQVEVWFQ  180
NRRARTKLKQ TEVDCEFLKR CCENLTEENR RLQKEVQELR ALKLSPQFYM QMTPPTTLTM  240
CPSCERVAGP PTPSPSGPTN VDPRVHQMGL AQQQRPMPFN LWATSPVPHR PINAVNPRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1181189RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009590186.10.0PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotQ054661e-105HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLM1AXL41e-151M1AXL4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000325461e-151(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.11e-103homeobox protein 2